Mineralocorticoid Receptor antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer:
GTX00779
- Bilder (0)
| Artikelname: | Mineralocorticoid Receptor antibody, Unconjugated, Rabbit, Polyclonal |
| Artikelnummer: | GTX00779 |
| Hersteller Artikelnummer: | GTX00779 |
| Alternativnummer: | GTX00779-100 |
| Hersteller: | GeneTex |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | WB |
| Spezies Reaktivität: | Human, Mouse, Rat |
| Immunogen: | This antibody was raised against a synthetic peptide corresponding to a sequence at the C-terminus of human NR3C2 (950-984aa HALKVEFPAMLVEIISDQLPKVESGNAKPLYFHRK), different from the related mouse sequence by one amino acid, and from the related rat seque |
| Konjugation: | Unconjugated |
| Alternative Synonym: | nuclear receptor subfamily 3 group C member 2 , MCR , MLR , MR , NR3C2VIT |
| Klonalität: | Polyclonal |
| Konzentration: | 0.5 mg/ml (Please refer to the vial label for the specific concentration.) |
| Molekulargewicht: | 107 |
| Sensitivitaet: | Superfamily members of NR3C2 are not reactive to this antibody. |
| NCBI: | 4306 |
| UniProt: | P08235 |
| Puffer: | 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg Sodium azide. |
| Formulierung: | Liquid |
| Anwendungsbeschreibung: | WB: 0.1-0.5µg/ml. *Optimal dilutions/concentrations should be determined by the researcher.Not tested in other applications. |
Produktgarantie und fachkundiger Support
