Rab11A antibody [4H9], IgG2b, Unconjugated, Mouse, Monoclonal

Produktübersicht

• Artikelname: Rab11A antibody [4H9], IgG2b, Unconjugated, Mouse, Monoclonal
• Artikelnummer: GTX03669
• Hersteller Artikelnummer: GTX03669
• Alternativnummer: GTX03669-100
• Hersteller: GeneTex
• Wirt: Mouse
• Kategorie: Antikörper
• Applikation: FACS, ICC, IHC-P, WB
• Spezies Reaktivität: Human, Mouse, Rat
• Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Rab11A (171-211aa EIYRIVSQKQMSDRRENDMSPSNNVVPIHVPPTTENKPKVQ), identical to the related mouse and rat sequences.
• Konjugation: Unconjugated
• Alternative Synonym: RAB11A, member RAS oncogene family , YL8

Produkteigenschaften

• Klonalität: Monoclonal
• Konzentration: 0.5 mg/ml (Please refer to the vial label for the specific concentration.)
• Klon-Bezeichnung: [4H9]
• Molekulargewicht: 24
• Isotyp: IgG2b
• NCBI: 8766
• UniProt: P62491
• Puffer: 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, no preservative.
• Formulierung: Liquid

Anwendungsbeschreibung

• Anwendungsbeschreibung: WB: 0.25-0.5 µg/ml. ICC/IF: 5 µg/ml. IHC-P: 2-5 µg/ml. FACS: 1-3 µg/1x106cells. *Optimal dilutions/concentrations should be determined by the researcher.Not tested in other applications.