sfTSLP (63 aa peptide)

Artikelnummer: ISC-AB-010
Artikelname: sfTSLP (63 aa peptide)
Artikelnummer: ISC-AB-010
Hersteller Artikelnummer: AB-010
Alternativnummer: ISC-AB-010
Hersteller: Isca Biochemicals
Kategorie: Biochemikalien
sfTSLP (63 aa peptide) is an antibacterial peptide derived as the 63 amino acid sequence of the short form of thymic stromal lymphopoietin (sfTSLP). Thymic stromal lymphopoietin (TSLP) is a cytokine first identified in a mouse model as a B-cell growth fa
Molekulargewicht: 7425.86
NCBI: 2015
Reinheit: >95% by hplc
Formulierung: Freeze dried solid
Sequenz: MFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ
Formel: C327H543N101O86S5
Target-Kategorie: Antibacterials
Anwendungsbeschreibung: ProductType: Antimicrobial peptides