sfTSLP (60 aa peptide)

Artikelnummer: ISC-AB-020
Artikelname: sfTSLP (60 aa peptide)
Artikelnummer: ISC-AB-020
Hersteller Artikelnummer: AB-020
Alternativnummer: ISC-AB-020
Hersteller: Isca Biochemicals
Kategorie: Biochemikalien
sfTSLP (60 aa peptide) is an antibacterial peptide derived as the 60 amino acid sequence of the short form of thymic stromal lymphopoietin (sfTSLP). Thymic stromal lymphopoietin (TSLP) is a cytokine first identified in a mouse model as a B-cell growth fa
Molekulargewicht: 7076.41
NCBI: 2015
Reinheit: >95% by hplc
Formulierung: Freeze dried solid
Sequenz: MKTKAALAIWCPGYSETQINATQAMKK RRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ
Formel: C310H520N98O83S4
Target-Kategorie: Antibacterials
Anwendungsbeschreibung: ProductType: Antimicrobial peptides