LL 37 (human), CAS [[154947-66-7]]

Artikelnummer: ISC-AM-001
Artikelname: LL 37 (human), CAS [[154947-66-7]]
Artikelnummer: ISC-AM-001
Hersteller Artikelnummer: AM-001
Alternativnummer: ISC-AM-001
Hersteller: Isca Biochemicals
Kategorie: Biochemikalien
Alternative Synonym: Ropocamptide, hCAP 18, Cathelicidin, LL 37, LL-37, cathelicidin, LL 37 (human)
LL 37 (human) is a 37 amino acid host defence peptide derived from the C-terminal of human cathelicidin antimicrobial peptide (CAMP, hCAP18), which has antimicrobial, antitumour, antiviral and immunomodulatory properties and also has physiological functi
Molekulargewicht: 4493.3
NCBI: 2013
Reinheit: >95% by HPLC
Formulierung: Freeze dried solid
Sequenz: [LL-37, 37 aa]
CAS Nummer: [154947-66-7]
Formel: C205H340N60O53
Target-Kategorie: Antibacterials,Antivirals
Anwendungsbeschreibung: ProductType: Antimicrobial peptides