LL 37 (human) scrambled

Artikelnummer: ISC-AM-002
Artikelname: LL 37 (human) scrambled
Artikelnummer: ISC-AM-002
Hersteller Artikelnummer: AM-002
Alternativnummer: ISC-AM-002
Hersteller: Isca Biochemicals
Kategorie: Biochemikalien
LL 37, a 37 amino acid host defence peptide derived from the C-terminal of human cathelicidin antimicrobial peptide (CAMP, hCAP18), has antimicrobial, antitumour, antiviral and immunomodulatory properties and also has physiological functions in chemotaxi
Molekulargewicht: 4493.3
NCBI: 2013
Reinheit: >95% by HPLC
Formulierung: Freeze dried solid
Sequenz: GLKLRFEFSKIKGEFLKTPEVRFRDIKLKDNRISVQR
Formel: C205H340N60O53
Target-Kategorie: Antibacterials
Anwendungsbeschreibung: ProductType: Peptides