LL 37 (human) biotinylated

Artikelnummer: ISC-AM-003
Artikelname: LL 37 (human) biotinylated
Artikelnummer: ISC-AM-003
Hersteller Artikelnummer: AM-003
Alternativnummer: ISC-AM-003
Hersteller: Isca Biochemicals
Kategorie: Biochemikalien
LL 37 (human) biotinylated is the N-terminally biotinylated version of the host defence peptide LL 37. The biotin group is attached via a 6-carbon spacer, 6-aminohexanoic acid (Ahx). The presence of the biotin tag allows numerous biochemical and microbio
Molekulargewicht: 4832.5
NCBI: 2013
Reinheit: >95% by HPLC
Formulierung: Freeze dried solid
Sequenz: Biotin-Ahx[LL-37, 37 aa]
Formel: C221H366N64O55S
Target-Kategorie: Antibacterials
Anwendungsbeschreibung: ProductType: Biotin labelled peptides