LL 37 (human), 5-FAM

Artikelnummer: ISC-AM-004
Artikelname: LL 37 (human), 5-FAM
Artikelnummer: ISC-AM-004
Hersteller Artikelnummer: AM-004
Alternativnummer: ISC-AM-004
Hersteller: Isca Biochemicals
Kategorie: Biochemikalien
LL 37 (human), 5-FAM is the N-terminally carboxyfluoresceinated derivative of the host defence peptide LL 37. The carboxyfluorescein group is attached via a 6-carbon spacer, 6-aminohexanoic acid (Ahx). The presence of the carboxyfluorescein tag allows fl
Molekulargewicht: 4963.6
NCBI: 2013
Reinheit: >95% by HPLC
Formulierung: Freeze dried solid
Sequenz: 5FAM-Ahx[LL-37, 37 aa]
Formel: C226H351N61O58
Target-Kategorie: Antibacterials
Anwendungsbeschreibung: ProductType: Fluorescent labelled peptides