mCRAMP (mouse)

Artikelnummer: ISC-AM-040
Artikelname: mCRAMP (mouse)
Artikelnummer: ISC-AM-040
Hersteller Artikelnummer: AM-040
Alternativnummer: ISC-AM-040
Hersteller: Isca Biochemicals
Kategorie: Biochemikalien
Alternative Synonym: Mouse calethicidin related antimicrobial peptide
mCRAMP (mouse) or mouse calethicidin-related antimicrobial peptide, is the sole murine cathelicidin and intestinal homologue of human LL-37. mCRAMP expression in the intestinal tract is restricted to surface epithelial cells in the colon where it exhibit
Molekulargewicht: 3878.7
NCBI: 2015
Reinheit: >95% by HPLC
Formulierung: Freeze dried solid
Sequenz: GLLRKGGEKIGEKLKKIGQKIKNFFQKLVPQPEQ
Formel: C178H302N50O46
Target-Kategorie: Antibacterials,Antivirals
Anwendungsbeschreibung: ProductType: Antimicrobial peptides