RsAFP2

Artikelnummer: ISC-AM-140
Artikelname: RsAFP2
Artikelnummer: ISC-AM-140
Hersteller Artikelnummer: AM-140
Alternativnummer: ISC-AM-140
Hersteller: Isca Biochemicals
Kategorie: Biochemikalien
Alternative Synonym: Raphanus sativus antifungal peptide 2
RsAFP2, or raphanus sativus antifungal peptide 2, is an an antifungal plant defensin isolated from seeds of the radish, raphanus sativus, which interacts with glucosylceramides (GlcCer) in the membranes of susceptible yeast and fungi to induce membrane p
Molekulargewicht: 5710.6
NCBI: 2007
Reinheit: >95% by HPLC
Formulierung: Freeze dried solid
Sequenz: PyroGlu-KLCQRPSGTWSGVCGNNNACKNQCIRLEKARHGSCNYVFPAHKCICYFPC
Formel: C244H368N76O68S8
Target-Kategorie: Antifungals,Plant science
Anwendungsbeschreibung: ProductType: Antimicrobial peptides