Candidalysin, CAS [[1906866-53-2]]

Artikelnummer: ISC-AM-390
Artikelname: Candidalysin, CAS [[1906866-53-2]]
Artikelnummer: ISC-AM-390
Hersteller Artikelnummer: AM-390
Alternativnummer: ISC-AM-390
Hersteller: Isca Biochemicals
Kategorie: Biochemikalien
Alternative Synonym: Ece1-III62-92K , CL
Candidalysin is a peptide generated by kexin-like proteinase posttranslational processing of the 271-amino-acid preproprotein Ece1p, and is the dominant peptide secreted by the pathogen Candida albicans hyphae during mucosal infection. Candidalysin is a
Molekulargewicht: 3307.95
NCBI: 2016
Reinheit: >95% by hplc
Formulierung: Freeze dried solid
Sequenz: SIIGIIMGILGNIPQVIQIIMSIVKAFKGNK
CAS Nummer: [1906866-53-2]
Formel: C153H266N38O38S2
Target-Kategorie: Antifungals
Anwendungsbeschreibung: ProductType: Peptides