Apelin 36 (human), CAS [[252642-12-9]]

Artikelnummer: ISC-AR-010
Artikelname: Apelin 36 (human), CAS [[252642-12-9]]
Artikelnummer: ISC-AR-010
Hersteller Artikelnummer: AR-010
Alternativnummer: ISC-AR-010
Hersteller: Isca Biochemicals
Kategorie: Biochemikalien
Apelin-36 (human) is an endogenous apelin receptor agonist that is secreted by adipocytes. Apelin-36 (human) binds with high affinity to human apelin receptors expressed in HEK 293 cells (pIC50= 8.61) and is linked to two major types of biological activi
Molekulargewicht: 4195.87
NCBI: 1998
Reinheit: >95% by hplc
Formulierung: Freeze dried solid
Sequenz: LVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF
CAS Nummer: [252642-12-9]
Formel: C184H297N69O43S
Target-Kategorie: Apelin receptors
Anwendungsbeschreibung: ProductType: Peptides