NT1-20

Artikelnummer: ISC-AS-010
Artikelname: NT1-20
Artikelnummer: ISC-AS-010
Hersteller Artikelnummer: AS-010
Alternativnummer: ISC-AS-010
Hersteller: Isca Biochemicals
Kategorie: Biochemikalien
Alternative Synonym: Peptide NT1-20
NT1-20 is a tatylated membrane penetrating peptide derived from the N-terminus of the acid sensing ion channel 1a (ASIC1a), which can block ASIC1a binding receptor interacting protein kinase 1 (RIPK1) to its C terminus. ASIC1a mediates necroptosis via re
Molekulargewicht: 3655.22
NCBI: 2020
Reinheit: >95% by hplc
Formulierung: Freeze dried solid
Sequenz: GRKKRRQRRRCMELKTEEEEVGGVQPVSIQA
Formel: C150H265N55O47S2
Target-Kategorie: Protein-protein interactions,Kinases,Acid sensing ion channels
Anwendungsbeschreibung: ProductType: Cell penetrating peptides