CRF (human, rat), CAS [[86784-80-7]]

Artikelnummer: ISC-CR-020
Artikelname: CRF (human, rat), CAS [[86784-80-7]]
Artikelnummer: ISC-CR-020
Hersteller Artikelnummer: CR-020
Alternativnummer: ISC-CR-020
Hersteller: Isca Biochemicals
Kategorie: Biochemikalien
Alternative Synonym: Corticotropin releasing factor (human, rat), Corticotropin releasing hormone, CRH
CRF (human, rat) is an endogenous peptide derived from a 196-amino acid preprohormone which acts as an agonist for CRF receptors, with Ki values of 11, 44 and 38 nM for hCRF1, rCRF2a and mCRF2b respectively. CRF (human, rat) is a major regulator of the h
Molekulargewicht: 4757.51
NCBI: 1981
Reinheit: >95% by hplc
Formulierung: Freeze dried solid
Sequenz: SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII-NH2
CAS Nummer: [86784-80-7]
Formel: C208H344N60O63S2
Target-Kategorie: Corticotropin releasing factor receptors
Anwendungsbeschreibung: ProductType: Peptides