P9R

Artikelnummer: ISC-CV-060
Artikelname: P9R
Artikelnummer: ISC-CV-060
Hersteller Artikelnummer: CV-060
Alternativnummer: ISC-CV-060
Hersteller: Isca Biochemicals
Kategorie: Biochemikalien
P9R is a defensin-like peptide that exhibits potent antiviral activity against pH-dependent viruses, including the avian influenza A(H7N9) virus, coronaviruses (SARS-CoV-2, MERS-CoV and SARS-CoV), and the non-enveloped rhinovirus. The antiviral activity
Molekulargewicht: 3412.1
NCBI: 2020
Reinheit: >95% by HPLC
Formulierung: Freeze dried solid
Sequenz: NGAICWGPCPTAFRQIGNCGRFRVRCCRIR
Formel: C144H232N52O35S5
Target-Kategorie: Antivirals
Anwendungsbeschreibung: ProductType: Antimicrobial peptides