Galanin (human), CAS [[119418-04-1]]

Artikelnummer: ISC-GA-020
Artikelname: Galanin (human), CAS [[119418-04-1]]
Artikelnummer: ISC-GA-020
Hersteller Artikelnummer: GA-020
Alternativnummer: ISC-GA-020
Hersteller: Isca Biochemicals
Kategorie: Biochemikalien
Alternative Synonym: Galanin (1-30) (human)
Galanin (human) is an endogenous peptide with high affinity for all three galanin receptors and multiple endocrine, metabolic and behavioural effects. Named galanin after its N-terminal glycine and its C-terminal alanine, galanin (human) is widely expres
Molekulargewicht: 3155.55
NCBI: 1991
Reinheit: >95% by hplc
Formulierung: Freeze dried solid
Sequenz: GWTLNSAGYLLGPHAVGNHRSFSDKNGLTS
CAS Nummer: [119418-04-1]
Formel: C139H210N42O43
Target-Kategorie: Galanin receptors
Anwendungsbeschreibung: ProductType: Peptides