Galanin (1-29) (rat, mouse), CAS [[114547-31-8]]

Artikelnummer: ISC-GA-030
Artikelname: Galanin (1-29) (rat, mouse), CAS [[114547-31-8]]
Artikelnummer: ISC-GA-030
Hersteller Artikelnummer: GA-030
Alternativnummer: ISC-GA-030
Hersteller: Isca Biochemicals
Kategorie: Biochemikalien
Galanin (1-29) (rat, mouse) is a non-selective galanin receptor agonist, with Ki values of 0.98, 1.48 and 1.47 nM for GAL1, GAL2 and GAL3 respectively. Galanin (1-29) (rat, mouse) is an anticonvulsant which can prevent the occurrence of full kindled seiz
Molekulargewicht: 3164.48
NCBI: 1989
Reinheit: >95% by hplc
Formulierung: Freeze dried solid
Sequenz: GWTLNSAGYLLGPHAIDNHRSFSDKHGLT-NH2
CAS Nummer: [114547-31-8]
Formel: C141H211N43O41
Target-Kategorie: Galanin receptors
Anwendungsbeschreibung: ProductType: Peptides