Exendin-4, CAS [[141758-74-9]]

Artikelnummer: ISC-GH-001
Artikelname: Exendin-4, CAS [[141758-74-9]]
Artikelnummer: ISC-GH-001
Hersteller Artikelnummer: GH-001
Alternativnummer: ISC-GH-001
Hersteller: Isca Biochemicals
Kategorie: Biochemikalien
Alternative Synonym: Exenatide
Exendin-4, also known as exenatide, is a high affinity glucagon-like peptide 1 (GLP-1) receptor agonist originally isolated from Heloderma suspectum venom. It has 50% amino acid homology to GLP-1 and a longer half-life in vivo, and potentiates glucose-in
Molekulargewicht: 4186.6
NCBI: 1992
Reinheit: >95% by HPLC
Formulierung: Freeze dried solid
Sequenz: HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2
CAS Nummer: [141758-74-9]
Formel: C184H282N50O60S
Target-Kategorie: Glucagon and related receptors
Anwendungsbeschreibung: ProductType: Peptides