Exendin-4 (3-39) amide, CAS [[196109-31-6]]

Artikelnummer: ISC-GH-008
Artikelname: Exendin-4 (3-39) amide, CAS [[196109-31-6]]
Artikelnummer: ISC-GH-008
Hersteller Artikelnummer: GH-008
Alternativnummer: ISC-GH-008
Hersteller: Isca Biochemicals
Kategorie: Biochemikalien
Exendin-4 (3-39) amide is a potent glucagon-like peptide 1 (GLP-1) receptor antagonist. GLP-1 is a G protein-coupled receptor (GPCR) that shares sequence identity with other Family B receptors such as those for secretin, glucagon, and vasoactive intestin
Molekulargewicht: 3992.4
NCBI: 1
Reinheit: >95% by HPLC
Formulierung: Freeze dried solid
Sequenz: EGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2
CAS Nummer: [196109-31-6]
Formel: C176H272N46O58S
Target-Kategorie: Glucagon and related receptors
Anwendungsbeschreibung: ProductType: Peptides