Exendin-4 (5-39) amide

Artikelnummer: ISC-GH-009
Artikelname: Exendin-4 (5-39) amide
Artikelnummer: ISC-GH-009
Hersteller Artikelnummer: GH-009
Alternativnummer: ISC-GH-009
Hersteller: Isca Biochemicals
Kategorie: Biochemikalien
Exendin-4 (5-39) is an antagonist of glucagon-like peptide 1 (GLP-1) receptors. GLP-1 is a G protein-coupled receptor (GPCR) that shares sequence identity with other Family B receptors such as those for secretin, glucagon, and vasoactive intestinal pepti
Molekulargewicht: 3806.2
NCBI: 2013
Reinheit: >95% by HPLC
Formulierung: Freeze dried solid
Sequenz: TFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2
Formel: C169H262N44O54S
Target-Kategorie: Glucagon and related receptors
Anwendungsbeschreibung: ProductType: Peptides