Exendin-4 (9-39) amide, CAS [[133514-43-9]]

Artikelnummer: ISC-GH-010
Artikelname: Exendin-4 (9-39) amide, CAS [[133514-43-9]]
Artikelnummer: ISC-GH-010
Hersteller Artikelnummer: GH-010
Alternativnummer: ISC-GH-010
Hersteller: Isca Biochemicals
Kategorie: Biochemikalien
Alternative Synonym: Exendin(9-39) amide, Avexitide, 9-39-Exendin 4 (Heloderma suspectum)
Exendin-4 (9-39) amide is a potent and selective glucagon-like peptide-1 (GLP-1) receptor antagonist with a Kd of 1.7 nM at cloned human GLP-1 receptors. Exendin-4 (9-39) amide inhibits cAMP production and insulin release caused by GLP-1 (7-36) and exend
Molekulargewicht: 3369.8 Da
NCBI: 1991
Reinheit: >95% by HPLC
Formulierung: Freeze dried solid
Sequenz: DLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2
CAS Nummer: [133514-43-9]
Formel: C149H234N40O47S
Target-Kategorie: Glucagon and related receptors
Anwendungsbeschreibung: ProductType: Peptides