GLP-1 (7-36) amide (human, rat), CAS [[107444-51-9]]

Artikelnummer: ISC-GH-050
Artikelname: GLP-1 (7-36) amide (human, rat), CAS [[107444-51-9]]
Artikelnummer: ISC-GH-050
Hersteller Artikelnummer: GH-050
Alternativnummer: ISC-GH-050
Hersteller: Isca Biochemicals
Kategorie: Biochemikalien
GLP-1 (7-36) amide is a potent insulinotropic incretin peptide hormone produced as a result of proteolytic post-translational modification of proglucagon in L-cells of the lower intestine. GLP-1 (7-36) amide displays high affinity for GLP-1 receptors exp
Molekulargewicht: 3297.7
NCBI: 2000
Reinheit: >95% by HPLC
Formulierung: Freeze dried solid
Sequenz: HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2
CAS Nummer: [107444-51-9]
Formel: C149H226N40O45
Target-Kategorie: Glucagon and related receptors
Anwendungsbeschreibung: ProductType: Peptides