Peptide YY (human), CAS [[118997-30-1]]

Artikelnummer: ISC-GH-110
Artikelname: Peptide YY (human), CAS [[118997-30-1]]
Artikelnummer: ISC-GH-110
Hersteller Artikelnummer: GH-110
Alternativnummer: ISC-GH-110
Hersteller: Isca Biochemicals
Kategorie: Biochemikalien
Alternative Synonym: PYY, PYY (1-36)
Peptide YY, also known as PYY and PYY (1-36) is a 36-amino acid peptide that is synthesized and released from enteroendocrine cells. Peptide YY was initially isolated from porcine intestinal extracts and named peptide YY due to the presence of tyrosine r
Molekulargewicht: 4049.5
NCBI: 1980
Reinheit: >95% by HPLC
Formulierung: Freeze dried solid
Sequenz: YPIKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2
CAS Nummer: [118997-30-1]
Formel: C194H295N55O57
Target-Kategorie: Neuropeptide Y receptors
Anwendungsbeschreibung: ProductType: Peptides