GIP (human), CAS [[100040-31-1]]

Artikelnummer: ISC-GH-150
Artikelname: GIP (human), CAS [[100040-31-1]]
Artikelnummer: ISC-GH-150
Hersteller Artikelnummer: GH-150
Alternativnummer: ISC-GH-150
Hersteller: Isca Biochemicals
Kategorie: Biochemikalien
Alternative Synonym: Gastric Inhibitory Polypeptide, Glucose dependent insulinotropic polypeptide
GIP (Gastric Inhibitory Polypeptide) is derived from a 153-amino acid proprotein encoded by the GIP gene and circulates as a biologically active 42-amino acid peptide. GIP is released by the K cells of the duodenum and jejunum in response to food intake
Molekulargewicht: 4983.6
NCBI: 1995
Reinheit: >95% by HPLC
Formulierung: Freeze dried solid
Sequenz: YAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ
CAS Nummer: [100040-31-1]
Formel: C226H338N60O66S
Target-Kategorie: Glucagon and related receptors
Anwendungsbeschreibung: ProductType: Peptides