GIP (1-39), CAS [[725474-97-5]]

Artikelnummer: ISC-GH-160
Artikelname: GIP (1-39), CAS [[725474-97-5]]
Artikelnummer: ISC-GH-160
Hersteller Artikelnummer: GH-160
Alternativnummer: ISC-GH-160
Hersteller: Isca Biochemicals
Kategorie: Biochemikalien
GIP (1-39) is a highly potent insulinotropic peptide, it is the endogenous truncated form of the incretin hormone GIP (Glucose-dependent Insulinotropic Polypeptide, or Gastric Inhibitory Polypeptide), a 42-amino acid peptide released by the K cells of th
Molekulargewicht: 4633.2
NCBI: 2004
Reinheit: >95% By HPLC
Formulierung: Freeze dried solid
Sequenz: YAEGTFISDYSIAMDKIRQQDFVNWLLAQKGKKSDWKHN
CAS Nummer: [725474-97-5]
Formel: C210H316N56O61S
Target-Kategorie: Glucagon and related receptors
Anwendungsbeschreibung: ProductType: Peptides