GIP-1 (3-42) (human), CAS [[1802086-25-4]]

Artikelnummer: ISC-GH-170
Artikelname: GIP-1 (3-42) (human), CAS [[1802086-25-4]]
Artikelnummer: ISC-GH-170
Hersteller Artikelnummer: GH-170
Alternativnummer: ISC-GH-170
Hersteller: Isca Biochemicals
Kategorie: Biochemikalien
GIP (3-42) is produced by cleavage of the first two amino acid residues at the N-terminal (Tyr1-Ala2) from GIP (1-42), also known as GIP, by the serine protease dipeptidyl peptidase IV (DPP-IV). GIP (3-42) itself has no biological activity, but it can co
Molekulargewicht: 4749.4
NCBI: 2006
Reinheit: >95% by HPLC
Formulierung: Freeze dried solid
Sequenz: EGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ
CAS Nummer: [1802086-25-4]
Formel: C214H324N58O63S
Target-Kategorie: Glucagon and related receptors
Anwendungsbeschreibung: ProductType: Peptides