GIP (porcine), CAS [[11063-17-5]]

Artikelnummer: ISC-GL-020
Artikelname: GIP (porcine), CAS [[11063-17-5]]
Artikelnummer: ISC-GL-020
Hersteller Artikelnummer: GL-020
Alternativnummer: ISC-GL-020
Hersteller: Isca Biochemicals
Kategorie: Biochemikalien
Alternative Synonym: Glucose dependent insulinotropic polypeptide (porcine), Gastric inhibitory peptide (porcine)
GIP is a member of a family of structurally related hormones that includes secretin, glucagon, and vasoactive intestinal peptide. GIP (human) differs from GIP (porcine) at residues 18 and 34. GIP is secreted from specific endocrine cells (K-cells) in the
Molekulargewicht: 4975.62
NCBI: 1986
Reinheit: >95% by hplc
Formulierung: Freeze dried solid
Sequenz: YAEGTFISDYSIAMDKIRQQDFVNWLLAQKGKKSDWKHNITQ
CAS Nummer: [11063-17-5]
Formel: C225H342N60O66S
Target-Kategorie: Glucagon and related receptors
Anwendungsbeschreibung: ProductType: Peptides