GLP-1 (7-37), CAS [[106612-94-6]]

Artikelnummer: ISC-GL-030
Artikelname: GLP-1 (7-37), CAS [[106612-94-6]]
Artikelnummer: ISC-GL-030
Hersteller Artikelnummer: GL-030
Alternativnummer: ISC-GL-030
Hersteller: Isca Biochemicals
Kategorie: Biochemikalien
Alternative Synonym: Glucagon like peptide 1 fragment 7-37 (human)
GLP-1 (7-37) is an endogenous truncated form of GLP-1 that arises from proglucagon processing in intestinal endocrine L cells, GLP-1 (7-37) acts as a GLP-1 receptor agonist and is an insulinotropic hormone that augments glucose induced insulin secretion.
Molekulargewicht: 3355.71
NCBI: 1995
Reinheit: >95% by hplc
Formulierung: Freeze dried solid
Sequenz: HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG
CAS Nummer: [106612-94-6]
Formel: C151H228N40O47
Target-Kategorie: Glucagon and related receptors
Anwendungsbeschreibung: ProductType: Peptides