GIP_HUMAN[22-51]

Artikelnummer: ISC-GL-040
Artikelname: GIP_HUMAN[22-51]
Artikelnummer: ISC-GL-040
Hersteller Artikelnummer: GL-040
Alternativnummer: ISC-GL-040
Hersteller: Isca Biochemicals
Kategorie: Biochemikalien
GIP_HUMAN[22-51] is a potent proatherosclerotic peptide hormone which has a common precursor with glucose-dependent insulinotropic polypeptide (GIP). Chronic infusion of GIP_HUMAN
Molekulargewicht: 3181.6
NCBI: 2021
Reinheit: >95% by hplc
Formulierung: Freeze dried solid
Sequenz: EKKEGHFSALPSLPVGSHAKVSSPQPRGPR
Formel: C140H226N44O41
Target-Kategorie: Glucagon and related receptors
Anwendungsbeschreibung: ProductType: Peptides