ACTH (1-39) (human), CAS [[12279-41-3]]

Artikelnummer: ISC-MC-020
Artikelname: ACTH (1-39) (human), CAS [[12279-41-3]]
Artikelnummer: ISC-MC-020
Hersteller Artikelnummer: MC-020
Alternativnummer: ISC-MC-020
Hersteller: Isca Biochemicals
Kategorie: Biochemikalien
Alternative Synonym: Adrenocorticotropic hormone, Corticotropin, ACTH (1-39)
ACTH (1-39) (human) is a melanocortin receptor 2 (MC2R) agonist with an EC50 of 57 pM. ACTH (1-39) (human), also known as corticotropin, is a cleavage product from the precursor proopiomelanocortin (POMC) and is a peptide hormone produced in the anterior
Molekulargewicht: 4541.1
NCBI: 1996
Reinheit: >95% by hplc
Formulierung: Freeze dried solid
Sequenz: SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF
CAS Nummer: [12279-41-3]
Formel: C207H308N56O58S
Target-Kategorie: Melanocortin receptors
Anwendungsbeschreibung: ProductType: Peptides