aCx26-pep

Artikelnummer: ISC-NR-200
Artikelname: aCx26-pep
Artikelnummer: ISC-NR-200
Hersteller Artikelnummer: NR-200
Alternativnummer: ISC-NR-200
Hersteller: Isca Biochemicals
Kategorie: Biochemikalien
Alternative Synonym: Cx26 peptide
aCx26-pep is a peptide consisting of the gap junction protein connexin 26 (Cx26) cytosolic tail sequence, coupled to antennapedia. Triple negative breast cancer (TNBC) is one of the most lethal and treatment resistant breast cancer subtypes and it contai
Molekulargewicht: 3477.97
Reinheit: >95% by hplc
Formulierung: Freeze dried solid
Sequenz: RQIKIWFQNRRMKWKKRYCSGKSKKPV-NH2
Formel: C158H260N52O33S2
Target-Kategorie: Nuclear receptor modulators,Protein-protein interactions
Anwendungsbeschreibung: ProductType: Cell penetrating peptides