Pancreatic polypeptide (human), CAS [[75976-10-2]]

Artikelnummer: ISC-NY-030
Artikelname: Pancreatic polypeptide (human), CAS [[75976-10-2]]
Artikelnummer: ISC-NY-030
Hersteller Artikelnummer: NY-030
Alternativnummer: ISC-NY-030
Hersteller: Isca Biochemicals
Kategorie: Biochemikalien
Alternative Synonym: Pancreatic polypeptide, PP
Pancreatic polypeptide (human) is an endogenous high affinity agonist for the human NPY Y4 receptor, with a Ki of 0.056 nM. Pancreatic polypeptide (human) is produced and secreted by PP cells of the pancreas which are primarily located in the Islets of L
Molekulargewicht: 4181.7
NCBI: 1995
Reinheit: >95%
Formulierung: Freeze dried solid
Sequenz: APLEPVYPGDNATPEQMAQYAADLRRYINMLTRPRY-NH2
CAS Nummer: [75976-10-2]
Formel: C185H287N53O54S2
Target-Kategorie: Neuropeptide Y receptors
Anwendungsbeschreibung: ProductType: Peptides