PACAP 27, CAS [[127317-03-7]]

Artikelnummer: ISC-PA-010
Artikelname: PACAP 27, CAS [[127317-03-7]]
Artikelnummer: ISC-PA-010
Hersteller Artikelnummer: PA-010
Alternativnummer: ISC-PA-010
Hersteller: Isca Biochemicals
Kategorie: Biochemikalien
Alternative Synonym: PACAP 1-27, Pituitary Adenylate Cyclase-Activating Polypeptide 1-27, PACAP-38 (1-27) amide (human, mouse, ovine, porcine, rat)
PACAP 27 is an endogenous neuropeptide and is the C-terminally truncated form of PACAP 38. PACAP 27 has considerable homology with vasoactive intestinal peptide (VIP) but is >100 fold more potent than VIP as an agonist of the PAC1 receptor. PACAP 27 func
Molekulargewicht: 3147.65
NCBI: 1997
Reinheit: >95% by hplc
Formulierung: Freeze dried solid
Sequenz: HSDGIFTDSYSRYRKQMAVKKYLAAVL-NH2
CAS Nummer: [127317-03-7]
Formel: C142H224N40O39S
Target-Kategorie: PACAP receptors
Anwendungsbeschreibung: ProductType: Peptides