PACAP 38, CAS [[124123-15-5]]

Artikelnummer: ISC-PA-020
Artikelname: PACAP 38, CAS [[124123-15-5]]
Artikelnummer: ISC-PA-020
Hersteller Artikelnummer: PA-020
Alternativnummer: ISC-PA-020
Hersteller: Isca Biochemicals
Kategorie: Biochemikalien
Alternative Synonym: Pituitary Adenylate Cyclase-Activating Polypeptide 1-38, PACAP 1-38
PACAP 38, or Pituitary adenylate cyclase activating polypeptide-38, is a widely distributed endogenous neuropeptide located in both sensory and parasympathetic perivascular nerve fibes. PACAP 38 acts primarily as a PAC1 agonist and is involved in neuropr
Molekulargewicht: 4534.32
NCBI: 1998
Reinheit: 95% by hplc
Formulierung: Freeze dried solid
Sequenz: HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH,,
CAS Nummer: [124123-15-5]
Formel: C,,,€,fH,f,f,N,+,fO,_,fS
Target-Kategorie: PACAP receptors
Anwendungsbeschreibung: ProductType: Peptides