PACAP (6-38), CAS [[143748-18-9]]

Artikelnummer: ISC-PA-030
Artikelname: PACAP (6-38), CAS [[143748-18-9]]
Artikelnummer: ISC-PA-030
Hersteller Artikelnummer: PA-030
Alternativnummer: ISC-PA-030
Hersteller: Isca Biochemicals
Kategorie: Biochemikalien
Alternative Synonym: PACAP 6-38, Pituitary adenylate cyclase activating polypeptide (6-38)
PACAP (6-38) is a potent and competitive pituitary adenylate cyclase-activating polypeptide receptor (PAC)1 antagonist with an IC50 of 2 nM. PACAP(6-38)] is a potent mast cell degranulator and has an agonistic effect on MrgB3-receptors expressed in oocyt
Molekulargewicht: 4024.8
NCBI: 1999
Reinheit: >95% by hplc
Formulierung: Freeze dried solid
Sequenz: FTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH2
CAS Nummer: [143748-18-9]
Formel: C182H300N56O45S
Target-Kategorie: PACAP receptors
Anwendungsbeschreibung: ProductType: Peptides