Parathyroid hormone (1-34) (human), CAS [[52232-67-4]]

Artikelnummer: ISC-PH-010
Artikelname: Parathyroid hormone (1-34) (human), CAS [[52232-67-4]]
Artikelnummer: ISC-PH-010
Hersteller Artikelnummer: PH-010
Alternativnummer: ISC-PH-010
Hersteller: Isca Biochemicals
Kategorie: Biochemikalien
Alternative Synonym: PTH 1-34, hPTH (1-34), Teriparatide, Human parathyroid hormone (1-34)
Parathyroid hormone (1-34) (human), also known as teriparatide or (PTH 1-34) is the N-terminal fragment of the intact hormone human parathyroid hormone (PTH), an 84-amino acid polypeptide secreted from the parathyroid gland. Intermittently administered p
Molekulargewicht: 4117.77
NCBI: 1997
Reinheit: >95%
Formulierung: Freeze fried solid
Sequenz: SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF
CAS Nummer: [52232-67-4]
Formel: C181H291N55O51S2
Target-Kategorie: Parathyroid hormone receptors
Anwendungsbeschreibung: ProductType: Peptides