Parathyroid hormone (1-34) (rat), CAS [[98614-76-7]]

Artikelnummer: ISC-PH-040
Artikelname: Parathyroid hormone (1-34) (rat), CAS [[98614-76-7]]
Artikelnummer: ISC-PH-040
Hersteller Artikelnummer: PH-040
Alternativnummer: ISC-PH-040
Hersteller: Isca Biochemicals
Kategorie: Biochemikalien
Alternative Synonym: pTH (1-34) (rat)
Parathyroid hormone (1-34) (rat) is a parathyroid hormone receptor agonist, which can increase serum parathyroid hormone levels and bone mass in rats. Parathyroid hormone (1-34) (rat) treatment significantly improved weight bearing and treadmill enduranc
Molekulargewicht: 4057.74
NCBI: 1997
Reinheit: >95% by hplc
Formulierung: Freeze dried solid
Sequenz: AVSEIQLMHNLGKHLASVERMQWLRKKLQDVHNF
CAS Nummer: [98614-76-7]
Formel: C180H291N55O48S2
Target-Kategorie: Parathyroid hormone receptors
Anwendungsbeschreibung: ProductType: Peptides