WaTx

Artikelnummer: ISC-PN-120
Artikelname: WaTx
Artikelnummer: ISC-PN-120
Hersteller Artikelnummer: PN-120
Alternativnummer: ISC-PN-120
Hersteller: Isca Biochemicals
Kategorie: Biochemikalien
Alternative Synonym: Wasabi receptor toxin
WaTx, also known as wasabi receptor toxin, is the active component of the venom of the Australian black rock scorpion Urodacus manicatus. WaTx targets the mechanical and chemical stress sensor transient receptor potential cation channel 1 (TRPA1), which
Molekulargewicht: 3855.3
NCBI: 2019
Reinheit: >95% by HPLC
Formulierung: Freeze dried solid
Sequenz: ASPQQAKYCYEQCNVNKVPFDQCYQMCSPLERS
Formel: C164H245N45O53S5
Target-Kategorie: Transient receptor potential (TRP) channels
Anwendungsbeschreibung: ProductType: Peptides