Tat-beclin 1, CAS [[1423821-88-8]]

Artikelnummer: ISC-PP-200
Artikelname: Tat-beclin 1, CAS [[1423821-88-8]]
Artikelnummer: ISC-PP-200
Hersteller Artikelnummer: PP-200
Alternativnummer: ISC-PP-200
Hersteller: Isca Biochemicals
Kategorie: Biochemikalien
Alternative Synonym: Tat-BECN1, Beclin-1 Activator I, beclin 1 peptide
Tat-beclin 1 is a cell permeable peptide derived from the domain of the autophagy protein beclin 1 that interacts with HIV-1 Nef, attached to the HIV-1 Tat protein transduction domain. Tat-beclin 1 activates beclin1 by competing against its negative regu
Molekulargewicht: 3741.15
NCBI: 2013
Reinheit: >95% by hplc
Formulierung: Freeze dried solid
Sequenz: YGRKKRRQRRRGGTNVFNATFEIWHDGEFGT
CAS Nummer: [1423821-88-8]
Formel: C164H251N57O45
Target-Kategorie: Protein-protein interactions,Antivirals
Anwendungsbeschreibung: ProductType: Cell penetrating peptides