TAT-HuR-HNS3

Artikelnummer: ISC-PP-370
Artikelname: TAT-HuR-HNS3
Artikelnummer: ISC-PP-370
Hersteller Artikelnummer: PP-370
Alternativnummer: ISC-PP-370
Hersteller: Isca Biochemicals
Kategorie: Biochemikalien
TAT-HuR-HNS3 is a cell penetrating peptide derived from the human antigen R - nucleocytoplasmic shuttling sequence (HuR-HNS) domain. HuR, also known as embryonic lethal abnormal vision-like 1 (ELAVL1) is a well characterized RNA-binding protein that incr
Molekulargewicht: 3696.9
NCBI: 2022
Reinheit: >95% by hplc
Formulierung: Freeze dried solid
Sequenz: YGRKKRRQRRRSPMGVDHMSGLSGVNVPGNASSG
Formel: C151H257N59O46S2
Target-Kategorie: Protein-protein interactions
Anwendungsbeschreibung: ProductType: Cell penetrating peptides