VIP, CAS [[40077-57-4]]

Artikelnummer: ISC-VP-010
Artikelname: VIP, CAS [[40077-57-4]]
Artikelnummer: ISC-VP-010
Hersteller Artikelnummer: VP-010
Alternativnummer: ISC-VP-010
Hersteller: Isca Biochemicals
Kategorie: Biochemikalien
Alternative Synonym: VIP (human, rat, mouse, rabbit, canine, porcine), Vasoactive intestinal peptide, Aviptadil
VIP (Vasoactive intestinal peptide) is a 28 amino acid peptide originally isolated from swine intestines and found to be vasoactive by dilating arterioles. VIP is widely distributed in both the central and peripheral nervous system and is released by bot
Molekulargewicht: 3325.8
NCBI: 2002
Reinheit: >95% by hplc
Formulierung: Freeze dried solid
Sequenz: HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2
CAS Nummer: [40077-57-4]
Formel: C147H238N44O42S
Target-Kategorie: Vasoactive intestinal peptide (VIP) receptors
Anwendungsbeschreibung: ProductType: Peptides