IHC-plus(TM) PVRL2 / CD112 Antibody LS-B15413, Unconjugated, Rabbit, Polyclonal

Produktübersicht

• Artikelname: IHC-plus(TM) PVRL2 / CD112 Antibody LS-B15413, Unconjugated, Rabbit, Polyclonal
• Artikelnummer: LS-B15413-50
• Hersteller Artikelnummer: LS-B15413-50
• Alternativnummer: LS-B15413-50
• Hersteller: LifeSpan Biosciences
• Wirt: Rabbit
• Kategorie: Antikörper
• Spezies Reaktivität: Human
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 382-479 of human PVRL2 (NP_002847.1). FILLRVRRRRKSPGGAGGGASGDGGFYDPKAQVLGNGDPVFWTPVVPGPMEPDGKDEEEEEEEEKAEKGLMLPPPPALEDDMESQLDGSLISRRAVYV
• Konjugation: Unconjugated
• Alternative Synonym: PVRL2, HVEB, Herpesvirus entry protein B, Poliovirus receptor-like 2, Nectin-2, PRR2, PVRR2, CD112, CD112 antigen, Herpes virus entry mediator B, Herpesvirus entry mediator B, NECTIN2

Produkteigenschaften

• Klonalität: Polyclonal
• Konzentration: 1.22 mg/ml
• NCBI: 5819
• Reinheit: Affinity purified
• Formulierung: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol

Anwendungsbeschreibung

• Anwendungsbeschreibung: IF (1:50 - 1:200), IHC (1:50 - 1:200), IHC-P (1:200), WB (1:500 - 1:2000)

Bilder

Western blot analysis of extracts of various cell lines.

Immunofluorescence analysis of HeLa cells.