Histone H3 Antibody LS-C332079, Unconjugated, Rabbit, Polyclonal

Produktübersicht

• Artikelname: Histone H3 Antibody LS-C332079, Unconjugated, Rabbit, Polyclonal
• Artikelnummer: LS-C332079-100
• Hersteller Artikelnummer: LS-C332079-100
• Alternativnummer: LS-C332079-100
• Hersteller: LifeSpan Biosciences
• Wirt: Rabbit
• Kategorie: Antikörper
• Spezies Reaktivität: Human, Mouse, Rat
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 50 to the C-Terminus of human HIST3H3 (NP_003484.1). REIRRYQKSTELLIRKLPFQRLMREIAQDFKTDLRFQSSAVMALQEACESYLVGLFEDTNLCVIHAKRVTIMPKDIQLARRIRGERA
• Konjugation: Unconjugated

Produkteigenschaften

• Klonalität: Polyclonal
• Reinheit: Affinity purified
• Formulierung: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol

Anwendungsbeschreibung

• Anwendungsbeschreibung: ChIP-Seq (1:50 - 1:200), ChrIP, IF (1:50 - 1:200), IHC (1:50 - 1:200), IP (1:20 - 1:50), WB (1:500 - 1:2000)

Bilder

Western blot analysis of extracts of various cells.

Immunohistochemistry of paraffin-embedded Rat liver tissue.

Immunoprecipitation analysis of 150ug extracts of MCF7 cells.