RAD50 Antibody LS-C332354, Unconjugated, Rabbit, Polyclonal

Artikelnummer: LS-C332354-100
Artikelname: RAD50 Antibody LS-C332354, Unconjugated, Rabbit, Polyclonal
Artikelnummer: LS-C332354-100
Hersteller Artikelnummer: LS-C332354-100
Alternativnummer: LS-C332354-100
Hersteller: LifeSpan Biosciences
Wirt: Rabbit
Kategorie: Antikörper
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human RAD50 (NP_005723.2). MSRIEKMSILGVRSFGIEDKDKQIITFFSPLTILVGPNGAGKTTIIECLKYICTGDFPPGTKGNTFVHDPKVAQETDVRAQIRLQFRDVNGELIAVQRSM
Konjugation: Unconjugated
Alternative Synonym: RAD50, DNA repair protein RAD50, HRad50, NBSLD, RAD50 (S. cerevisiae) homolog, RAD50 homolog (S. cerevisiae), RAD502, RAD50-2
Klonalität: Polyclonal
NCBI: 10111
Reinheit: Affinity purified
Formulierung: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Anwendungsbeschreibung: IF (1:50 - 1:100), IHC (1:50 - 1:200), IP (1:20 - 1:50), WB (1:500 - 1:2000)
Western blot analysis of extracts of various cell lines.
Immunohistochemistry of paraffin-embedded human metrocarcinoma tissue.
Immunofluorescence analysis of U2OS cells.