PVRL4 / Nectin 4 Antibody LS-C781892, Unconjugated, Rabbit, Polyclonal
Artikelnummer:
LS-C781892-100
| Artikelname: |
PVRL4 / Nectin 4 Antibody LS-C781892, Unconjugated, Rabbit, Polyclonal |
| Artikelnummer: |
LS-C781892-100 |
| Hersteller Artikelnummer: |
LS-C781892-100 |
| Alternativnummer: |
LS-C781892-100 |
| Hersteller: |
LifeSpan Biosciences |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Spezies Reaktivität: |
Human |
| Immunogen: |
Amino acids 53-94 (FYRGDSGEQVGQVAWARVDAGEGAQELALLHSKYGLHVSPAY) from the human protein were used as the immunogen for the Nectin-4 antibody. |
| Konjugation: |
Unconjugated |
| Alternative Synonym: |
PVRL4, EDSS1, Nectin 4, Ig superfamily receptor LNIR, Poliovirus receptor-like 4, LNIR, Nectin-4, Poliovirus receptor-related 4 |
| Klonalität: |
Polyclonal |
| NCBI: |
81607 |
| Reinheit: |
Antigen Affinity purification |
| Formulierung: |
Lyophilized from PBS, 2.5% BSA, 0.025% sodium azide. |
| Anwendungsbeschreibung: |
WB (0.5 - 1 µg/ml) |
