[KO Validated] RB Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA0003T
Artikelname: [KO Validated] RB Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA0003T
Hersteller Artikelnummer: CNA0003T
Alternativnummer: MBL-CNA0003T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Human
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 500-600 of human RB (NP_000312.2).
Konjugation: Unconjugated
Alternative Synonym: RB, pRb, OSRC, pp110, p105-Rb, PPP1R130, p110-RB1
Klonalität: Polyclonal
Molekulargewicht: 106kDa
NCBI: 5925
UniProt: P06400
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: RSTSQNLDSGTDLSFPWILNVLNLKAFDFYKVIESFIKAEGNLTREMIKHLERCEHRIMESLAWLSDSPLFDLIKQSKDREGPTDHLESACPLNLPLQNNH
Target-Kategorie: RB1
Application Verdünnung: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200