PTEN Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA0008P
Artikelname: PTEN Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA0008P
Hersteller Artikelnummer: CNA0008P
Alternativnummer: MBL-CNA0008P
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-186 of human PTEN (NP_000305.3).
Konjugation: Unconjugated
Alternative Synonym: BZS, DEC, CWS1, GLM2, MHAM, TEP1, MMAC1, PTEN1, 10q23del, PTENbeta
Klonalität: Polyclonal
Molekulargewicht: 47kDa
NCBI: 5728
UniProt: P60484
Puffer: PBS with 0.05% proclin300,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.05% proclin300,50% glycerol
Sequenz: MTAIIKEIVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDDVVRFLDSKHKNHYKIYNLCAERHYDTAKFNCRVAQYPFEDHNPPQLELIKPFCEDLDQWLSEDDNHVAAIHCKAGKGRTGVMICAYLLHRGKFLKAQEALDFYGEVRTRDKKGVTIPSQRRYVYYYSYLLKNHL
Target-Kategorie: PTEN
Application Verdünnung: WB: WB,1:100 - 1:500|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200