Tyrosine Hydroxylase Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA0028T
Artikelname: Tyrosine Hydroxylase Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA0028T
Hersteller Artikelnummer: CNA0028T
Alternativnummer: MBL-CNA0028T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Mouse, Rat
Immunogen: A synTyrosine Hydroxylase etic peptide corresponding to a sequence wiTyrosine Hydroxylase in amino acids 1-100 of human Tyrosine Hydroxylase (NP_954986.2).
Konjugation: Unconjugated
Alternative Synonym: TYH, DYT14, DYT5b
Klonalität: Polyclonal
Molekulargewicht: 59kDa
NCBI: 7054
UniProt: P07101
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: MPTPDATTPQAKGFRRAVSELDAKQAEAIMVRGQGAPGPSLTGSPWPGTAAPAASYTPTPRSPRFIGRRQSLIEDARKEREAAVAAAAAAVPSEPGDPLE
Target-Kategorie: TH
Application Verdünnung: WB: WB,1:500 - 1:1000