STIP1 Rabbit mAb, Clone: [ARC1805], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA0036S
Artikelname: STIP1 Rabbit mAb, Clone: [ARC1805], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA0036S
Hersteller Artikelnummer: CNA0036S
Alternativnummer: MBL-CNA0036S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 2-98 of human STIP1 (P31948).
Konjugation: Unconjugated
Alternative Synonym: HOP, P60, STI1, STI1L, HEL-S-94n, IEF-SSP-3521
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC1805]
Molekulargewicht: 63kDa
NCBI: 10963
UniProt: P31948
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: EQVNELKEKGNKALSVGNIDDALQCYSEAIKLDPHNHVLYSNRSAAYAKKGDYQKAYEDGCKTVDLKPDWGKGYSRKAAALEFLNRFEEAKRTYEEG
Target-Kategorie: STIP1
Application Verdünnung: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200