Thioredoxin 1 (Trx1/TXN) Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA0053S
Artikelname: Thioredoxin 1 (Trx1/TXN) Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA0053S
Hersteller Artikelnummer: CNA0053S
Alternativnummer: MBL-CNA0053S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Thioredoxin 1 (Trx1/Thioredoxin 1 (Trx1/TXN)) (NP_003320.2).
Konjugation: Unconjugated
Alternative Synonym: TRX, TRDX, TRX1, Trx80
Klonalität: Polyclonal
Molekulargewicht: 12kDa
NCBI: 7295
UniProt: P10599
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEAT
Target-Kategorie: TXN
Application Verdünnung: WB: WB,1:100 - 1:500|IF/ICC,1:50 - 1:200